PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRAS
Protein Properties Length: 471aa    MW: 53024.4 Da    PI: 7.7608
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018100genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS264.63.4e-81814511374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl....fsevsPilkfs 94 
                  lv+ Ll++A+ +++++  +  + L      +s++g+ ++Rl++yf++AL++r+++++ ++  +  ++  ++ n++e+++a +      +   P+++++
  Lus10018100  81 LVQCLLNAANEMDHEKYDQSIRSLDICDSSSSKTGNLTERLVHYFAQALRTRVYNKSGGVPLSSVVEGFEQLNVEEAVTAPSPivglIYSKIPFYQVG 178
                  6899***************************************************776665555555555445444444442233449999******* PP

         GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                  +l+  qaI+++v++++r+HiiD+ i +G+QWpaL+qaL +R+ ++   l+iT+++    + ++ ++etgerL+++A+++++pf+f+++v++++ +++ 
  Lus10018100 179 QLVGVQAIVDSVKKSKRIHIIDLRIRNGMQWPALMQALITRSrRDLLVLKITAIVT---SCEDLVNETGERLSRLAKSMNIPFSFKTVVVTSILEIDQ 273
                  ******************************************66667********9...689************************************ PP

         GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                  ++++++p+E +++ + ++lh l  ++ +le     ++ +++++ P ++vv+e+ea++ns+sF++rf+e l yy+a fd++++ l ++++++++vE ++
  Lus10018100 274 SRFDLDPREEVVIFSEYALHGLIPDQIQLEA----LMIVIRNIHPAIMVVIEKEANLNSSSFAHRFVEVLFYYAAYFDCIDTCLDSNDKNKMVVESMF 367
                  ***********************88888888....*************************************************************** PP

         GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  l+ ++  ++ +e+a+   r  t   Wr+ ++++ + +++ls +a+++++ ll+ +  +   +v+ ++ slv gWkd p++s+S W+
  Lus10018100 368 LNAQVNGILVKEKAM--RRSVTIDVWRKFFGRFWMVEATLSPRAMDTVNVLLNSFLgGSCCTVDMNRRSLVVGWKDTPIFSLSTWK 451
                  **************9..788999********************************98888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.51855430IPR005202Transcription factor GRAS
PfamPF035141.2E-7881451IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MFHSPNLPTE TDDQTLGNQS LFSPVSVELL RKVVERIRTT SEQDISLPDI IRIAAARFIG  60
SSSEPPDLPP SNKVVTKEVE LVQCLLNAAN EMDHEKYDQS IRSLDICDSS SSKTGNLTER  120
LVHYFAQALR TRVYNKSGGV PLSSVVEGFE QLNVEEAVTA PSPIVGLIYS KIPFYQVGQL  180
VGVQAIVDSV KKSKRIHIID LRIRNGMQWP ALMQALITRS RRDLLVLKIT AIVTSCEDLV  240
NETGERLSRL AKSMNIPFSF KTVVVTSILE IDQSRFDLDP REEVVIFSEY ALHGLIPDQI  300
QLEALMIVIR NIHPAIMVVI EKEANLNSSS FAHRFVEVLF YYAAYFDCID TCLDSNDKNK  360
MVVESMFLNA QVNGILVKEK AMRRSVTIDV WRKFFGRFWM VEATLSPRAM DTVNVLLNSF  420
LGGSCCTVDM NRRSLVVGWK DTPIFSLSTW KFLRAKPHKP AKNKEKMNTC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-2710945131375GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.15e-45GRAS family protein